Lineage for d1qfwm_ (1qfw M:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2345800Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2346399Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (225 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. 2346660Domain d1qfwm_: 1qfw M: [20436]
    Other proteins in same PDB: d1qfwa_, d1qfwb_, d1qfwh1, d1qfwh2, d1qfwi1, d1qfwi2
    part of anti-[gonadotropin beta subunit] Fv
    complexed with nag

Details for d1qfwm_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit
PDB Compounds: (M:) antibody (anti beta subunit) (light chain)

SCOPe Domain Sequences for d1qfwm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfwm_ b.1.1.1 (M:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dieltqspksmsmsvgervtlsckasetvdsfvswyqqkpeqspkllifgasnrfsgvpd
rftgsgsatdftltissvqaedfadyhcgqtynhpytfgggtkleikr

SCOPe Domain Coordinates for d1qfwm_:

Click to download the PDB-style file with coordinates for d1qfwm_.
(The format of our PDB-style files is described here.)

Timeline for d1qfwm_: