Lineage for d2gf2b1 (2gf2 B:40-201)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350556Species Human (Homo sapiens) [TaxId:9606] [186944] (28 PDB entries)
  8. 1350609Domain d2gf2b1: 2gf2 B:40-201 [204359]
    Other proteins in same PDB: d2gf2a2, d2gf2b2, d2gf2c2, d2gf2d2
    automated match to d2cvza2

Details for d2gf2b1

PDB Entry: 2gf2 (more details), 2.38 Å

PDB Description: Crystal structure of human hydroxyisobutyrate dehydrogenase
PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2gf2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf2b1 c.2.1.0 (B:40-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycga

SCOPe Domain Coordinates for d2gf2b1:

Click to download the PDB-style file with coordinates for d2gf2b1.
(The format of our PDB-style files is described here.)

Timeline for d2gf2b1: