Lineage for d2gemb2 (2gem B:108-218)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373641Species Salmonella typhimurium [TaxId:602] [225102] (1 PDB entry)
  8. 1373645Domain d2gemb2: 2gem B:108-218 [204358]
    automated match to d1okja2

Details for d2gemb2

PDB Entry: 2gem (more details), 2.1 Å

PDB Description: 2.1a crystal structure of salmonella tyhpimurium yeaz, a putative gram-negative rpf, form-a
PDB Compounds: (B:) Putative Gram negative resuscitation promoting factor

SCOPe Domain Sequences for d2gemb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gemb2 c.55.1.0 (B:108-218) automated matches {Salmonella typhimurium [TaxId: 602]}
atrvlaaidarmgevywaeyqrdaqgvwqgeeteavlkpervgerlkqlsgewatvgtgw
sawpdlakecgltlhdgevslpaaedmlpiasqklaagetvavehaepvyl

SCOPe Domain Coordinates for d2gemb2:

Click to download the PDB-style file with coordinates for d2gemb2.
(The format of our PDB-style files is described here.)

Timeline for d2gemb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gemb1