Lineage for d2gemb1 (2gem B:1-107)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885547Species Salmonella typhimurium [TaxId:602] [225102] (1 PDB entry)
  8. 2885550Domain d2gemb1: 2gem B:1-107 [204357]
    automated match to d1okja1

Details for d2gemb1

PDB Entry: 2gem (more details), 2.1 Å

PDB Description: 2.1a crystal structure of salmonella tyhpimurium yeaz, a putative gram-negative rpf, form-a
PDB Compounds: (B:) Putative Gram negative resuscitation promoting factor

SCOPe Domain Sequences for d2gemb1:

Sequence, based on SEQRES records: (download)

>d2gemb1 c.55.1.0 (B:1-107) automated matches {Salmonella typhimurium [TaxId: 602]}
mrilaidtateacsvalwnngtinahfelcprehtqrilpmvqeilaasgaslneidala
fgrgpgsftgvrigigiaqglalganlpmigvstlatmaqgawrktg

Sequence, based on observed residues (ATOM records): (download)

>d2gemb1 c.55.1.0 (B:1-107) automated matches {Salmonella typhimurium [TaxId: 602]}
mrilaidtateacsvalwnngtinahfelcehtqrilpmvqeilaasgaslneidalafg
rgpgsftgvrigigiaqglalganlpmigvstlatmaqgawrktg

SCOPe Domain Coordinates for d2gemb1:

Click to download the PDB-style file with coordinates for d2gemb1.
(The format of our PDB-style files is described here.)

Timeline for d2gemb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gemb2