Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (49 species) not a true protein |
Species Salmonella typhimurium [TaxId:602] [225102] (1 PDB entry) |
Domain d2gema1: 2gem A:1-107 [204355] automated match to d1okja1 |
PDB Entry: 2gem (more details), 2.1 Å
SCOPe Domain Sequences for d2gema1:
Sequence, based on SEQRES records: (download)
>d2gema1 c.55.1.0 (A:1-107) automated matches {Salmonella typhimurium [TaxId: 602]} mrilaidtateacsvalwnngtinahfelcprehtqrilpmvqeilaasgaslneidala fgrgpgsftgvrigigiaqglalganlpmigvstlatmaqgawrktg
>d2gema1 c.55.1.0 (A:1-107) automated matches {Salmonella typhimurium [TaxId: 602]} mrilaidtateacsvalwnngtinahfelcehtqrilpmvqeilaasgaslneidalafg rgpgsftgvrigigiaqglalganlpmigvstlatmaqgawrktg
Timeline for d2gema1: