SCOPe 2.03: Domain d2gelg1: 2gel G:1-107

Lineage for d2gelg1 (2gel G:1-107)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [225103] (3 PDB entries)

8. Domain d2gelg1: 2gel G:1-107 [204353]
   automated match to d1okja1

Details for d2gelg1

PDB Entry: 2gel, 2.05 Å

PDB Description: 2.05a crystal structure of salmonella typhimurium yeaz, form b

PDB Compounds: (G:) Putative Gram negative resuscitation promoting factor

SCOPe Domain Sequences for d2gelg1:

Sequence; same for both SEQRES and ATOM records:

>d2gelg1 c.55.1.0 (G:1-107) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrilaidtateacsvalwnngtinahfelcprehtqrilpmvqeilaasgaslneidala
fgrgpgsftgvrigigiaqglalganlpmigvstlatmaqgawrktg

Timeline for d2gelg1:

• d2gelg1 is new in SCOPe 2.03-stable
  
• d2gelg1 appears in SCOPe 2.04
  
• d2gelg1 appears in the current release, SCOPe 2.08