Lineage for d2ge5b_ (2ge5 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371642Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1371643Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1371659Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 1371660Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 1371661Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 1371711Domain d2ge5b_: 2ge5 B: [204350]
    automated match to d1az3a_
    protein/DNA complex; complexed with ca; mutant

Details for d2ge5b_

PDB Entry: 2ge5 (more details), 2.4 Å

PDB Description: EcoRV Restriction Endonuclease C-terminal deletion mutant/GATATC/Ca2+
PDB Compounds: (B:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d2ge5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ge5b_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnye

SCOPe Domain Coordinates for d2ge5b_:

Click to download the PDB-style file with coordinates for d2ge5b_.
(The format of our PDB-style files is described here.)

Timeline for d2ge5b_: