SCOP 1.71: Domain d1qfwh_: 1qfw H:

Lineage for d1qfwh_ (1qfw H:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1qfwh_: 1qfw H: [20435]
   Other proteins in same PDB: d1qfwa_, d1qfwb_, d1qfwl_, d1qfwm_
   part of anti-[gonadotropin alpha subunit] Fv
   complexed with nag

Details for d1qfwh_

PDB Entry: 1qfw, 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit

SCOP Domain Sequences for d1qfwh_:

Sequence, based on SEQRES records:

>d1qfwh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qlqqsgaelvkpgasvklsckasdytftsywmhwvkqrpgqglewigeinptngrtyyne
kfkskatltvaasastaamqassltsedsavyycarrygnsfdywgqgttvtvss

Sequence, based on observed residues (ATOM records):

>d1qfwh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qlqqsgaelvkpgasvklsckasdytftsywmhwvkqrpgqglewigeinptngrtyyne
kkatltvaasastaamqassltsedsavyycarrygnsfdywgqgttvtvss

Timeline for d1qfwh_:

• d1qfwh_ first appeared (with stable ids) in SCOP 1.55
  
• d1qfwh_ appears in SCOP 1.69
  
• d1qfwh_ appears in SCOP 1.73
  
• d1qfwh_ appears in the current release, SCOPe 2.08, called d1qfwh1