SCOP 1.73: Domain d1qfwl_: 1qfw L:

Lineage for d1qfwl_ (1qfw L:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)

8. Domain d1qfwl_: 1qfw L: [20434]
   Other proteins in same PDB: d1qfwa_, d1qfwb_, d1qfwh_, d1qfwi_
   part of anti-[gonadotropin alpha subunit] Fv
   complexed with nag

Details for d1qfwl_

PDB Entry: 1qfw, 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit

PDB Compounds: (L:) antibody (anti alpha subunit) (light chain)

SCOP Domain Sequences for d1qfwl_:

Sequence, based on SEQRES records:

>d1qfwl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
dieltqspdslavslgqratiscrasesvdsygnsfmqwyqqkpgqppklliyrasnles
giparfsgtgsrtdftltinpveaddvatyycqqsdeypymytfgggtkleikr

Sequence, based on observed residues (ATOM records):

>d1qfwl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
dieltqspdslavslgqratiscrasedsygnsfmqwyqqkpgqppklliyrasnlesgi
parfsgtgsrtdftltinpveaddvatyycqqsdeypymytfgggtkleikr

Timeline for d1qfwl_:

• d1qfwl_ first appeared (with stable ids) in SCOP 1.55
  
• d1qfwl_ appears in SCOP 1.71
  
• d1qfwl_ appears in SCOP 1.75
  
• d1qfwl_ appears in the current release, SCOPe 2.08