SCOPe 2.05: Domain d2gcpa_: 2gcp A:

Lineage for d2gcpa_ (2gcp A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)

8. Domain d2gcpa_: 2gcp A: [204336]
   automated match to d2wm9b_
   complexed with edo, gsp, mg

Details for d2gcpa_

PDB Entry: 2gcp, 2.15 Å

PDB Description: Crystal structure of the human RhoC-GSP complex

PDB Compounds: (A:) Rho-related GTP-binding protein RhoC

SCOPe Domain Sequences for d2gcpa_:

Sequence; same for both SEQRES and ATOM records:

>d2gcpa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgacgktcllivfskdqfpevyvptvfenyiadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrq
dehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematraglqv

Timeline for d2gcpa_:

• d2gcpa_ first appeared in SCOPe 2.03
  
• d2gcpa_ appears in SCOPe 2.04
  
• d2gcpa_ appears in SCOPe 2.06
  
• d2gcpa_ appears in the current release, SCOPe 2.08