Lineage for d2gcoa1 (2gco A:-9-180)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125127Protein RhoC [142245] (1 species)
  7. 2125128Species Human (Homo sapiens) [TaxId:9606] [142246] (3 PDB entries)
    Uniprot P08134 1-179
  8. 2125129Domain d2gcoa1: 2gco A:-9-180 [204334]
    Other proteins in same PDB: d2gcoa2, d2gcob2
    automated match to d2wm9b_
    complexed with gnp, mg

Details for d2gcoa1

PDB Entry: 2gco (more details), 1.4 Å

PDB Description: Crystal structure of the human RhoC-GppNHp complex
PDB Compounds: (A:) Rho-related GTP-binding protein RhoC

SCOPe Domain Sequences for d2gcoa1:

Sequence, based on SEQRES records: (download)

>d2gcoa1 c.37.1.8 (A:-9-180) RhoC {Human (Homo sapiens) [TaxId: 9606]}
ssglvprgshmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyiadievdg
kqvelalwdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnv
piilvgnkkdlrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrev
fematraglq

Sequence, based on observed residues (ATOM records): (download)

>d2gcoa1 c.37.1.8 (A:-9-180) RhoC {Human (Homo sapiens) [TaxId: 9606]}
ssglvpaairkklvivgdgacgktcllivfskdqfpevyvptvfenyiadievdgkqvel
alwdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilv
gnkkdlrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfemat
raglq

SCOPe Domain Coordinates for d2gcoa1:

Click to download the PDB-style file with coordinates for d2gcoa1.
(The format of our PDB-style files is described here.)

Timeline for d2gcoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gcoa2