Lineage for d2gcna_ (2gcn A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125127Protein RhoC [142245] (1 species)
  7. 2125128Species Human (Homo sapiens) [TaxId:9606] [142246] (3 PDB entries)
    Uniprot P08134 1-179
  8. 2125131Domain d2gcna_: 2gcn A: [204333]
    automated match to d2wm9b_
    complexed with edo, gdp, mg

Details for d2gcna_

PDB Entry: 2gcn (more details), 1.85 Å

PDB Description: Crystal structure of the human RhoC-GDP complex
PDB Compounds: (A:) Rho-related GTP-binding protein RhoC

SCOPe Domain Sequences for d2gcna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gcna_ c.37.1.8 (A:) RhoC {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyiadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
qdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematragl

SCOPe Domain Coordinates for d2gcna_:

Click to download the PDB-style file with coordinates for d2gcna_.
(The format of our PDB-style files is described here.)

Timeline for d2gcna_: