SCOPe 2.03: Domain d2gcna_: 2gcn A:

Lineage for d2gcna_ (2gcn A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoC [142245] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142246] (3 PDB entries)
   Uniprot P08134 1-179

8. Domain d2gcna_: 2gcn A: [204333]
   automated match to d2wm9b_
   complexed with edo, gdp, mg

Details for d2gcna_

PDB Entry: 2gcn, 1.85 Å

PDB Description: Crystal structure of the human RhoC-GDP complex

PDB Compounds: (A:) Rho-related GTP-binding protein RhoC

SCOPe Domain Sequences for d2gcna_:

Sequence; same for both SEQRES and ATOM records:

>d2gcna_ c.37.1.8 (A:) RhoC {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyiadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
qdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematragl

Timeline for d2gcna_:

• d2gcna_ is new in SCOPe 2.03-stable
  
• d2gcna_ appears in SCOPe 2.04
  
• d2gcna_ appears in the current release, SCOPe 2.08