Lineage for d2gb4b_ (2gb4 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893960Family c.66.1.36: Thiopurine S-methyltransferase [102566] (1 protein)
    automatically mapped to Pfam PF05724
  6. 2893961Protein Thiopurine S-methyltransferase [102567] (3 species)
  7. 2893966Species Mouse (Mus musculus) [TaxId:10090] [225137] (3 PDB entries)
  8. 2893968Domain d2gb4b_: 2gb4 B: [204322]
    automated match to d2bzga1
    complexed with sah

Details for d2gb4b_

PDB Entry: 2gb4 (more details), 1.25 Å

PDB Description: crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution
PDB Compounds: (B:) thiopurine s-methyltransferase

SCOPe Domain Sequences for d2gb4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gb4b_ c.66.1.36 (B:) Thiopurine S-methyltransferase {Mouse (Mus musculus) [TaxId: 10090]}
aevqknqvltledwkekwvtrhisfhqeqghqllkkhldtflkgqsglrvffplcgkaie
mkwfadrghtvvgveiseigireffaeqnlsyteeplaeiagakvfksssgsislyccsi
fdlpranigkfdriwdrgalvainpgdhdryadiilsllrkefqylvavlsydptkhagp
pfyvpsaelkrlfgtkcsmqcleevdaleerhkawgldylfeklylltek

SCOPe Domain Coordinates for d2gb4b_:

Click to download the PDB-style file with coordinates for d2gb4b_.
(The format of our PDB-style files is described here.)

Timeline for d2gb4b_: