SCOP 1.55: Domain d1cu4l1: 1cu4 L:1-106A

Lineage for d1cu4l1 (1cu4 L:1-106A)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Anti-prion Fab 3F4, (mouse), kappa L chain [48891] (2 PDB entries)

8. Domain d1cu4l1: 1cu4 L:1-106A [20432]
   Other proteins in same PDB: d1cu4h2, d1cu4l2

Details for d1cu4l1

PDB Entry: 1cu4, 2.9 Å

PDB Description: crystal structure of the anti-prion fab 3f4 in complex with its peptide epitope

SCOP Domain Sequences for d1cu4l1:

Sequence; same for both SEQRES and ATOM records:

>d1cu4l1 b.1.1.1 (L:1-106A) Immunoglobulin (variable domains of L and H chains) {Anti-prion Fab 3F4, (mouse), kappa L chain}
dvvmtqtplslsvtigqpasisckssqslldsdgktyliwvfqrpgqspkrliflvskrd
sgvpdrftgsgsgtdftlkisrveaedvgvyycwqgthfphtvgggtkleia

SCOP Domain Coordinates for d1cu4l1 are not available.

Timeline for d1cu4l1:

• d1cu4l1 appears in SCOP 1.57
  
• d1cu4l1 appears in the current release, SCOPe 2.08