Lineage for d2g7mz1 (2g7m Z:1-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906434Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2906826Protein Transcarbamylase-like protein [75308] (1 species)
  7. 2906827Species Bacteroides fragilis [TaxId:817] [75309] (4 PDB entries)
  8. 2906856Domain d2g7mz1: 2g7m Z:1-163 [204318]
    Other proteins in same PDB: d2g7mc3, d2g7md3, d2g7me3, d2g7mx3, d2g7my3, d2g7mz3
    automated match to d1js1x1
    complexed with an0, cp, so4; mutant

Details for d2g7mz1

PDB Entry: 2g7m (more details), 2.9 Å

PDB Description: crystal structure of b. fragilis n-succinylornithine transcarbamylase p90e mutant complexed with carbamoyl phosphate and n-acetylnorvaline
PDB Compounds: (Z:) putative ornithine carbamoyltransferase

SCOPe Domain Sequences for d2g7mz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g7mz1 c.78.1.1 (Z:1-163) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]}
mkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqkaaln
lgmnvivldinqgawkletergvimdgdkeehlleaipvmgcycdiigvrsfarfenrey
dyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykk

SCOPe Domain Coordinates for d2g7mz1:

Click to download the PDB-style file with coordinates for d2g7mz1.
(The format of our PDB-style files is described here.)

Timeline for d2g7mz1: