| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
| Protein Transcarbamylase-like protein [75308] (1 species) |
| Species Bacteroides fragilis [TaxId:817] [75309] (4 PDB entries) |
| Domain d2g7my2: 2g7m Y:164-318 [204317] Other proteins in same PDB: d2g7mc3, d2g7md3, d2g7me3, d2g7mx3, d2g7my3, d2g7mz3 automated match to d1js1x2 complexed with an0, cp, so4; mutant |
PDB Entry: 2g7m (more details), 2.9 Å
SCOPe Domain Sequences for d2g7my2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g7my2 c.78.1.1 (Y:164-318) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]}
tarpkvvmtwaphprplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarveydq
mkafegadfiyaknwaaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrnmiv
tddviespqsivipeaanreisatvvlkrllenlp
Timeline for d2g7my2: