SCOPe 2.03: Domain d2g7my1: 2g7m Y:-2-163

Lineage for d2g7my1 (2g7m Y:-2-163)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Transcarbamylase-like protein [75308] (1 species)

7. Species Bacteroides fragilis [TaxId:817] [75309] (4 PDB entries)

8. Domain d2g7my1: 2g7m Y:-2-163 [204316]
   automated match to d1js1x1
   complexed with an0, cp, so4; mutant

Details for d2g7my1

PDB Entry: 2g7m, 2.9 Å

PDB Description: crystal structure of b. fragilis n-succinylornithine transcarbamylase p90e mutant complexed with carbamoyl phosphate and n-acetylnorvaline

PDB Compounds: (Y:) putative ornithine carbamoyltransferase

SCOPe Domain Sequences for d2g7my1:

Sequence; same for both SEQRES and ATOM records:

>d2g7my1 c.78.1.1 (Y:-2-163) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]}
gshmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqka
alnlgmnvivldinqgawkletergvimdgdkeehlleaipvmgcycdiigvrsfarfen
reydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykk

Timeline for d2g7my1:

• d2g7my1 is new in SCOPe 2.03-stable
  
• d2g7my1 appears in SCOPe 2.04
  
• d2g7my1 appears in the current release, SCOPe 2.08