Lineage for d2g6ya_ (2g6y A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2548166Species Pontellina plumata [TaxId:239963] [225060] (3 PDB entries)
  8. 2548167Domain d2g6ya_: 2g6y A: [204304]
    Other proteins in same PDB: d2g6yb2
    automated match to d3kcsa_

Details for d2g6ya_

PDB Entry: 2g6y (more details), 1.6 Å

PDB Description: crystal structure of the novel green fluorescent protein from marine copepod pontellina plumata
PDB Compounds: (A:) green fluorescent protein 2

SCOPe Domain Sequences for d2g6ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g6ya_ d.22.1.0 (A:) automated matches {Pontellina plumata [TaxId: 239963]}
ameiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfyh
fgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvmgtgfp
edsviftdkiirsnatvehlhpmgdndldgsftrtfslrdggyyssvvdshmhfksaihp
silqnggpmfafrrveedhsntelgiveyqhafktp

SCOPe Domain Coordinates for d2g6ya_:

Click to download the PDB-style file with coordinates for d2g6ya_.
(The format of our PDB-style files is described here.)

Timeline for d2g6ya_: