SCOPe 2.08: Domain d2g6fx1: 2g6f X:10-63

Lineage for d2g6fx1 (2g6f X:10-63)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries)

8. Domain d2g6fx1: 2g6f X:10-63 [204299]
   Other proteins in same PDB: d2g6fx2
   automated match to d2p4ra_
   complexed with nco

Details for d2g6fx1

PDB Entry: 2g6f, 0.92 Å

PDB Description: Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2

PDB Compounds: (X:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d2g6fx1:

Sequence; same for both SEQRES and ATOM records:

>d2g6fx1 b.34.2.1 (X:10-63) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei

Timeline for d2g6fx1:

• d2g6fx1 first appeared in SCOPe 2.03, called d2g6fx_
  
• d2g6fx1 appears in SCOPe 2.07