Lineage for d2g4fa_ (2g4f A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831332Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (10 PDB entries)
  8. 2831349Domain d2g4fa_: 2g4f A: [204297]
    automated match to d1e0xa_
    mutant

Details for d2g4fa_

PDB Entry: 2g4f (more details), 2.65 Å

PDB Description: structure of s.olivaceoviridis xylanase q88a/r275a mutant
PDB Compounds: (A:) hydrolase

SCOPe Domain Sequences for d2g4fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g4fa_ c.1.8.3 (A:) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsaqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswasgdtpllfngdgskkaaytavlnal
ng

SCOPe Domain Coordinates for d2g4fa_:

Click to download the PDB-style file with coordinates for d2g4fa_.
(The format of our PDB-style files is described here.)

Timeline for d2g4fa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2g4fb_