Lineage for d2g4fa_ (2g4f A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein automated matches [190057] (28 species)
not a true protein
Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (10 PDB entries) 
Domain d2g4fa_: 2g4f A: [204297]
automated match to d1e0xa_
mutant
Details for d2g4fa_
PDB Entry: 2g4f (more details), 2.65 Å
PDB Description: structure of s.olivaceoviridis xylanase q88a/r275a mutant
PDB Compounds: (A:) hydrolaseSCOPe Domain Sequences for d2g4fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g4fa_ c.1.8.3 (A:) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsaqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswasgdtpllfngdgskkaaytavlnal
ng
SCOPe Domain Coordinates for d2g4fa_:
Click to download the PDB-style file with coordinates for d2g4fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g4fa_:
- d2g4fa_ first appeared in SCOPe 2.03
- d2g4fa_ appears in SCOPe 2.07
View in 3D
