SCOPe 2.04: Domain d2g3oe_: 2g3o E:

Lineage for d2g3oe_ (2g3o E:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (18 species)
   not a true protein

7. Species Pontellina plumata [TaxId:239963] [225060] (3 PDB entries)

8. Domain d2g3oe_: 2g3o E: [204295]
   automated match to d3kcsa_

Details for d2g3oe_

PDB Entry: 2g3o, 2.1 Å

PDB Description: the 2.1a crystal structure of copgfp

PDB Compounds: (E:) green fluorescent protein 2

SCOPe Domain Sequences for d2g3oe_:

Sequence; same for both SEQRES and ATOM records:

>d2g3oe_ d.22.1.0 (E:) automated matches {Pontellina plumata [TaxId: 239963]}
pamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfy
hfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtgf
pedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksaih
psilqnggpmfafrrveelhsntelgiveyqhafktpi

Timeline for d2g3oe_:

• d2g3oe_ first appeared in SCOPe 2.03
  
• d2g3oe_ appears in SCOPe 2.05
  
• d2g3oe_ appears in the current release, SCOPe 2.08