Lineage for d2g3oc_ (2g3o C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941109Species Pontellina plumata [TaxId:239963] [225060] (3 PDB entries)
  8. 2941120Domain d2g3oc_: 2g3o C: [204293]
    automated match to d3kcsa_

Details for d2g3oc_

PDB Entry: 2g3o (more details), 2.1 Å

PDB Description: the 2.1a crystal structure of copgfp
PDB Compounds: (C:) green fluorescent protein 2

SCOPe Domain Sequences for d2g3oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3oc_ d.22.1.0 (C:) automated matches {Pontellina plumata [TaxId: 239963]}
pamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfy
hfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtgf
pedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksaih
psilqnggpmfafrrveelhsntelgiveyqhafktpi

SCOPe Domain Coordinates for d2g3oc_:

Click to download the PDB-style file with coordinates for d2g3oc_.
(The format of our PDB-style files is described here.)

Timeline for d2g3oc_: