| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Pontellina plumata [TaxId:239963] [225060] (3 PDB entries) |
| Domain d2g3oc_: 2g3o C: [204293] automated match to d3kcsa_ |
PDB Entry: 2g3o (more details), 2.1 Å
SCOPe Domain Sequences for d2g3oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3oc_ d.22.1.0 (C:) automated matches {Pontellina plumata [TaxId: 239963]}
pamkiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfy
hfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvvgtgf
pedsviftdkiirsnatvehlhpmgdnvlvgsfartfslrdggyysfvvdshmhfksaih
psilqnggpmfafrrveelhsntelgiveyqhafktpi
Timeline for d2g3oc_: