SCOPe 2.03: Domain d2g2rl2: 2g2r L:108-214

Lineage for d2g2rl2 (2g2r L:108-214)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d2g2rl2: 2g2r L:108-214 [204288]
   Other proteins in same PDB: d2g2ra1, d2g2rl1
   automated match to d1dqdl2
   complexed with so4, tns

Details for d2g2rl2

PDB Entry: 2g2r, 2.75 Å

PDB Description: Green-fluorescent antibody 11G10 in complex with its hapten (nitro-stilbene derivative)

PDB Compounds: (L:) Green-fluorescent antibody (11G10)-light chain

SCOPe Domain Sequences for d2g2rl2:

Sequence; same for both SEQRES and ATOM records:

>d2g2rl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2g2rl2:

• d2g2rl2 is new in SCOPe 2.03-stable
  
• d2g2rl2 appears in SCOPe 2.04
  
• d2g2rl2 appears in the current release, SCOPe 2.08