SCOPe 2.08: Domain d2g2rl1: 2g2r L:1-107

Lineage for d2g2rl1 (2g2r L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2g2rl1: 2g2r L:1-107 [204287]
   Other proteins in same PDB: d2g2ra2, d2g2rb1, d2g2rb2, d2g2rh1, d2g2rh2, d2g2rl2
   automated match to d1dqdl1
   complexed with so4, tns

Details for d2g2rl1

PDB Entry: 2g2r, 2.75 Å

PDB Description: Green-fluorescent antibody 11G10 in complex with its hapten (nitro-stilbene derivative)

PDB Compounds: (L:) Green-fluorescent antibody (11G10)-light chain

SCOPe Domain Sequences for d2g2rl1:

Sequence; same for both SEQRES and ATOM records:

>d2g2rl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpltlsvtigqpasiscrssqsllyingkthlnwllqrpgqspkrliylvskld
sgvpdrfsgsgsgtdftlkisrveaedlgiyfclqsthfpltfgagtklelk

Timeline for d2g2rl1:

• d2g2rl1 first appeared in SCOPe 2.03
  
• d2g2rl1 appears in SCOPe 2.07