Lineage for d2g2ra2 (2g2r A:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752744Domain d2g2ra2: 2g2r A:108-214 [204286]
    Other proteins in same PDB: d2g2ra1, d2g2rb1, d2g2rb2, d2g2rh1, d2g2rh2, d2g2rl1
    automated match to d1dqdl2
    complexed with so4, tns

Details for d2g2ra2

PDB Entry: 2g2r (more details), 2.75 Å

PDB Description: Green-fluorescent antibody 11G10 in complex with its hapten (nitro-stilbene derivative)
PDB Compounds: (A:) Green-fluorescent antibody (11G10)-light chain

SCOPe Domain Sequences for d2g2ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g2ra2 b.1.1.2 (A:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d2g2ra2:

Click to download the PDB-style file with coordinates for d2g2ra2.
(The format of our PDB-style files is described here.)

Timeline for d2g2ra2: