SCOPe 2.07: Domain d2fy5a2: 2fy5 A:392-607

Lineage for d2fy5a2 (2fy5 A:392-607)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Choline O-acetyltransferase [110591] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [225187] (4 PDB entries)

8. Domain d2fy5a2: 2fy5 A:392-607 [204280]
   automated match to d1q6xa2
   complexed with sop

Details for d2fy5a2

PDB Entry: 2fy5, 2.6 Å

PDB Description: structures of ligand bound human choline acetyltransferase provide insight into regulation of acetylcholine synthesis

PDB Compounds: (A:) choline O-acetyltransferase

SCOPe Domain Sequences for d2fy5a2:

Sequence; same for both SEQRES and ATOM records:

>d2fy5a2 c.43.1.3 (A:392-607) Choline O-acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
dfivykfdnygktfikkqkcspdafiqvalqlafyrlhrrlvptyesasirrfqegrvdn
irsatpealafvravtdhkaavpasekllllkdairaqtaytvmaitgmaidnhllalre
laramcaalpemfmdetylmsnrfvlstsqvptttemfccygpvvpngygacynpqpeti
lfcissfhscaatssskfakaveeslidmrdlcsll

Timeline for d2fy5a2:

• d2fy5a2 first appeared in SCOPe 2.03
  
• d2fy5a2 appears in SCOPe 2.06
  
• d2fy5a2 appears in the current release, SCOPe 2.08