Lineage for d2fy5a2 (2fy5 A:392-607)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130379Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2130380Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2130473Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 2130513Protein Choline O-acetyltransferase [110591] (2 species)
  7. 2130514Species Human (Homo sapiens) [TaxId:9606] [225187] (4 PDB entries)
  8. 2130522Domain d2fy5a2: 2fy5 A:392-607 [204280]
    automated match to d1q6xa2
    complexed with sop

Details for d2fy5a2

PDB Entry: 2fy5 (more details), 2.6 Å

PDB Description: structures of ligand bound human choline acetyltransferase provide insight into regulation of acetylcholine synthesis
PDB Compounds: (A:) choline O-acetyltransferase

SCOPe Domain Sequences for d2fy5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fy5a2 c.43.1.3 (A:392-607) Choline O-acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
dfivykfdnygktfikkqkcspdafiqvalqlafyrlhrrlvptyesasirrfqegrvdn
irsatpealafvravtdhkaavpasekllllkdairaqtaytvmaitgmaidnhllalre
laramcaalpemfmdetylmsnrfvlstsqvptttemfccygpvvpngygacynpqpeti
lfcissfhscaatssskfakaveeslidmrdlcsll

SCOPe Domain Coordinates for d2fy5a2:

Click to download the PDB-style file with coordinates for d2fy5a2.
(The format of our PDB-style files is described here.)

Timeline for d2fy5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fy5a1