SCOPe 2.07: Domain d1ejol1: 1ejo L:2001-2111

Lineage for d1ejol1 (1ejo L:2001-2111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)

8. Domain d1ejol1: 1ejo L:2001-2111 [20428]
   Other proteins in same PDB: d1ejoh1, d1ejoh2, d1ejol2
   part of anti-FMDV Fab 4C4

Details for d1ejol1

PDB Entry: 1ejo, 2.3 Å

PDB Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.

PDB Compounds: (L:) igg2a monoclonal antibody (light chain)

SCOPe Domain Sequences for d1ejol1:

Sequence; same for both SEQRES and ATOM records:

>d1ejol1 b.1.1.1 (L:2001-2111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdsygnsfmhwyqqkpgqppklliyrasnles
giparfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtklelk

Timeline for d1ejol1:

• d1ejol1 first appeared (with stable ids) in SCOP 1.55
  
• d1ejol1 appears in SCOPe 2.06
  
• d1ejol1 appears in the current release, SCOPe 2.08