Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) |
Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins) Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains |
Protein Choline O-acetyltransferase [110591] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [225187] (4 PDB entries) |
Domain d2fy3a2: 2fy3 A:392-609 [204276] automated match to d1q6xa2 complexed with cht, gol |
PDB Entry: 2fy3 (more details), 2.27 Å
SCOPe Domain Sequences for d2fy3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fy3a2 c.43.1.3 (A:392-609) Choline O-acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} dfivykfdnygktfikkqkcspdafiqvalqlafyrlhrrlvptyesasirrfqegrvdn irsatpealafvravtdhkaavpasekllllkdairaqtaytvmaitgmaidnhllalre laramcaalpemfmdetylmsnrfvlstsqvptttemfccygpvvpngygacynpqpeti lfcissfhscaatssskfakaveeslidmrdlcsllpp
Timeline for d2fy3a2: