SCOPe 2.03: Domain d2fvhc_: 2fvh C:

Lineage for d2fvhc_ (2fvh C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.0: automated matches [193589] (1 protein)
   not a true family

6. Protein automated matches [193590] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [226780] (1 PDB entry)

8. Domain d2fvhc_: 2fvh C: [204271]
   automated match to d4furd_

Details for d2fvhc_

PDB Entry: 2fvh, 1.8 Å

PDB Description: Crystal Structure of Rv1848, a Urease Gamma Subunit UreA (Urea amidohydrolase), from Mycobacterium Tuberculosis

PDB Compounds: (C:) urease gamma subunit

SCOPe Domain Sequences for d2fvhc_:

Sequence; same for both SEQRES and ATOM records:

>d2fvhc_ d.8.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rltpheqerlllsyaaelarrrrarglrlnhpeaiaviadhilegardgrtvaelmasgr
evlgrddvmegvpemlaevqveatfpdgtklvtvhqpia

Timeline for d2fvhc_:

• d2fvhc_ is new in SCOPe 2.03-stable
  
• d2fvhc_ appears in SCOPe 2.04
  
• d2fvhc_ appears in the current release, SCOPe 2.08