Lineage for d2fvhc_ (2fvh C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928867Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2928868Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2928956Family d.8.1.0: automated matches [193589] (1 protein)
    not a true family
  6. 2928957Protein automated matches [193590] (3 species)
    not a true protein
  7. 2928965Species Mycobacterium tuberculosis [TaxId:1773] [226780] (1 PDB entry)
  8. 2928968Domain d2fvhc_: 2fvh C: [204271]
    automated match to d4furd_

Details for d2fvhc_

PDB Entry: 2fvh (more details), 1.8 Å

PDB Description: Crystal Structure of Rv1848, a Urease Gamma Subunit UreA (Urea amidohydrolase), from Mycobacterium Tuberculosis
PDB Compounds: (C:) urease gamma subunit

SCOPe Domain Sequences for d2fvhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fvhc_ d.8.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rltpheqerlllsyaaelarrrrarglrlnhpeaiaviadhilegardgrtvaelmasgr
evlgrddvmegvpemlaevqveatfpdgtklvtvhqpia

SCOPe Domain Coordinates for d2fvhc_:

Click to download the PDB-style file with coordinates for d2fvhc_.
(The format of our PDB-style files is described here.)

Timeline for d2fvhc_: