Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) |
Family d.8.1.0: automated matches [193589] (1 protein) not a true family |
Protein automated matches [193590] (3 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [226780] (1 PDB entry) |
Domain d2fvhb_: 2fvh B: [204270] automated match to d4furd_ |
PDB Entry: 2fvh (more details), 1.8 Å
SCOPe Domain Sequences for d2fvhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fvhb_ d.8.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} rltpheqerlllsyaaelarrrrarglrlnhpeaiaviadhilegardgrtvaelmasgr evlgrddvmegvpemlaevqveatfpdgtklvtvhqpia
Timeline for d2fvhb_: