Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [48889] (3 PDB entries) |
Domain d1dqmh1: 1dqm H:2-113 [20427] Other proteins in same PDB: d1dqmh2, d1dqml2 |
PDB Entry: 1dqm (more details), 2.1 Å
SCOP Domain Sequences for d1dqmh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqmh1 b.1.1.1 (H:2-113) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain} vqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyhp slksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss
Timeline for d1dqmh1: