Lineage for d2fpma1 (2fpm A:5-64)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715792Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715793Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. 2715794Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)
  7. 2715805Species Methanococcus voltae [TaxId:2188] [109872] (11 PDB entries)
    Uniprot O73948
  8. 2715811Domain d2fpma1: 2fpm A:5-64 [204258]
    Other proteins in same PDB: d2fpma2
    automated match to d1t4ga1
    complexed with anp, k, mg

Details for d2fpma1

PDB Entry: 2fpm (more details), 2 Å

PDB Description: rada recombinase in complex with amp-pnp and high concentration of k+
PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d2fpma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fpma1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Methanococcus voltae [TaxId: 2188]}
ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf

SCOPe Domain Coordinates for d2fpma1:

Click to download the PDB-style file with coordinates for d2fpma1.
(The format of our PDB-style files is described here.)

Timeline for d2fpma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fpma2