Lineage for d2fora_ (2for A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010549Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 protein domains)
  6. 2010594Protein automated matches [190489] (5 species)
    not a true protein
  7. 2010663Species Shigella flexneri [TaxId:623] [225048] (1 PDB entry)
  8. 2010664Domain d2fora_: 2for A: [204252]
    Other proteins in same PDB: d2forb2
    automated match to d1rqjb_
    complexed with ipr, po4

Details for d2fora_

PDB Entry: 2for (more details), 2 Å

PDB Description: crystal structure of the shigella flexneri farnesyl pyrophosphate synthase complex with an isopentenyl pyrophosphate
PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d2fora_:

Sequence, based on SEQRES records: (download)

>d2fora_ a.128.1.1 (A:) automated matches {Shigella flexneri [TaxId: 623]}
dfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfgv
stntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtla
fsilsdanmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrhk
tgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqga
dqqlgkstypallgleqarkkardliddarqalkqlaeqsldtsalealadyiiqrnk

Sequence, based on observed residues (ATOM records): (download)

>d2fora_ a.128.1.1 (A:) automated matches {Shigella flexneri [TaxId: 623]}
dfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfgv
stntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtla
fsilsdanmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrhk
tgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvggkstypallgl
eqarkkardliddarqalkqlaeqsldtsalealadyiiqrnk

SCOPe Domain Coordinates for d2fora_:

Click to download the PDB-style file with coordinates for d2fora_.
(The format of our PDB-style files is described here.)

Timeline for d2fora_: