SCOPe 2.03: Domain d1dqjb1: 1dqj B:1-113

Lineage for d1dqjb1 (1dqj B:1-113)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)

8. Domain d1dqjb1: 1dqj B:1-113 [20425]
   Other proteins in same PDB: d1dqja1, d1dqja2, d1dqjb2, d1dqjc_
   part of anti-lysozyme Fab HYHEL-63

Details for d1dqjb1

PDB Entry: 1dqj, 2 Å

PDB Description: crystal structure of the anti-lysozyme antibody hyhel-63 complexed with hen egg white lysozyme

PDB Compounds: (B:) anti-lysozyme antibody hyhel-63 (heavy chain)

SCOPe Domain Sequences for d1dqjb1:

Sequence; same for both SEQRES and ATOM records:

>d1dqjb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyh
pslksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss

Timeline for d1dqjb1:

• d1dqjb1 first appeared (with stable ids) in SCOP 1.55
  
• d1dqjb1 appears in SCOPe 2.02
  
• d1dqjb1 appears in SCOPe 2.04
  
• d1dqjb1 appears in the current release, SCOPe 2.08