Lineage for d1dqjb1 (1dqj B:1-113)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287702Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (17 PDB entries)
  8. 287711Domain d1dqjb1: 1dqj B:1-113 [20425]
    Other proteins in same PDB: d1dqja1, d1dqja2, d1dqjb2, d1dqjc_
    part of anti-lysozyme Fab HYHEL-63

Details for d1dqjb1

PDB Entry: 1dqj (more details), 2 Å

PDB Description: crystal structure of the anti-lysozyme antibody hyhel-63 complexed with hen egg white lysozyme

SCOP Domain Sequences for d1dqjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqjb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2}
evqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyh
pslksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss

SCOP Domain Coordinates for d1dqjb1:

Click to download the PDB-style file with coordinates for d1dqjb1.
(The format of our PDB-style files is described here.)

Timeline for d1dqjb1: