SCOP 1.59: Domain d1dqjb1: 1dqj B:1-113

Lineage for d1dqjb1 (1dqj B:1-113)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [48889] (3 PDB entries)

8. Domain d1dqjb1: 1dqj B:1-113 [20425]
   Other proteins in same PDB: d1dqja2, d1dqjb2, d1dqjc_

Details for d1dqjb1

PDB Entry: 1dqj, 2 Å

PDB Description: crystal structure of the anti-lysozyme antibody hyhel-63 complexed with hen egg white lysozyme

SCOP Domain Sequences for d1dqjb1:

Sequence; same for both SEQRES and ATOM records:

>d1dqjb1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain}
evqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyh
pslksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss

Timeline for d1dqjb1:

• d1dqjb1 first appeared (with stable ids) in SCOP 1.55
  
• d1dqjb1 appears in SCOP 1.57
  
• d1dqjb1 appears in SCOP 1.61
  
• d1dqjb1 appears in the current release, SCOPe 2.08