Lineage for d1dqjb1 (1dqj B:1-113)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51779Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [48889] (3 PDB entries)
  8. 51785Domain d1dqjb1: 1dqj B:1-113 [20425]
    Other proteins in same PDB: d1dqja2, d1dqjb2, d1dqjc_

Details for d1dqjb1

PDB Entry: 1dqj (more details), 2 Å

PDB Description: crystal structure of the anti-lysozyme antibody hyhel-63 complexed with hen egg white lysozyme

SCOP Domain Sequences for d1dqjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqjb1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain}
evqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyh
pslksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss

SCOP Domain Coordinates for d1dqjb1:

Click to download the PDB-style file with coordinates for d1dqjb1.
(The format of our PDB-style files is described here.)

Timeline for d1dqjb1: