SCOPe 2.06: Domain d2fn8a_: 2fn8 A:

Lineage for d2fn8a_ (2fn8 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (70 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [187722] (4 PDB entries)

8. Domain d2fn8a_: 2fn8 A: [204247]
   automated match to d2fn9a_
   complexed with rip

Details for d2fn8a_

PDB Entry: 2fn8, 2.15 Å

PDB Description: thermotoga maritima ribose binding protein ribose bound form

PDB Compounds: (A:) ribose ABC transporter, periplasmic ribose-binding protein

SCOPe Domain Sequences for d2fn8a_:

Sequence; same for both SEQRES and ATOM records:

>d2fn8a_ c.93.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
kgkmaivistlnnpwfvvlaetakqraeqlgyeatifdsqndtakesahfdaiiaagyda
iifnptdadgsianvkrakeagipvfcvdrginarglavaqiysdnyyggvlmgeyfvkf
lkekypdakeipyaellgilsaqptwdrsngfhsvvdqypefkmvaqqsaefdrdtaykv
teqilqahpeikaiwcgndamalgamkaceaagrtdiyifgfdgaedvinaikegkqiva
timqfpklmarlavewadqylrgersfpeivpvtvelvtrenidkytaygrk

Timeline for d2fn8a_:

• d2fn8a_ first appeared in SCOPe 2.03
  
• d2fn8a_ appears in SCOPe 2.05
  
• d2fn8a_ appears in SCOPe 2.07
  
• d2fn8a_ appears in the current release, SCOPe 2.08