Lineage for d2fn7a1 (2fn7 A:17-164)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844354Protein Lactate dehydrogenase [51859] (19 species)
  7. 2844384Species Cryptosporidium parvum [TaxId:5807] [225185] (10 PDB entries)
  8. 2844405Domain d2fn7a1: 2fn7 A:17-164 [204243]
    Other proteins in same PDB: d2fn7a2, d2fn7b2
    automated match to d1ez4a1
    complexed with gol, lac, nad

Details for d2fn7a1

PDB Entry: 2fn7 (more details), 2.3 Å

PDB Description: crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with substrate (lactic acid) and cofactor (b- nicotinamide adenine dinucleotide)
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d2fn7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fn7a1 c.2.1.5 (A:17-164) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
tnpldvmvshfqkvsglphnkvcgma

SCOPe Domain Coordinates for d2fn7a1:

Click to download the PDB-style file with coordinates for d2fn7a1.
(The format of our PDB-style files is described here.)

Timeline for d2fn7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fn7a2