Lineage for d2fmyc2 (2fmy C:2139-2219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694643Species Carboxydothermus hydrogenoformans [TaxId:129958] [225204] (1 PDB entry)
  8. 2694646Domain d2fmyc2: 2fmy C:2139-2219 [204240]
    Other proteins in same PDB: d2fmya1, d2fmya3, d2fmyb1, d2fmyb3, d2fmyc1, d2fmyc3, d2fmyd1, d2fmyd3
    automated match to d1ft9a1
    complexed with hem, imd

Details for d2fmyc2

PDB Entry: 2fmy (more details), 2.2 Å

PDB Description: CO-dependent transcription factor CooA from Carboxydothermus hydrogenoformans (Imidazole-bound form)
PDB Compounds: (C:) carbon monoxide oxidation system transcription regulator CooA-1

SCOPe Domain Sequences for d2fmyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmyc2 a.4.5.0 (C:2139-2219) automated matches {Carboxydothermus hydrogenoformans [TaxId: 129958]}
darlrlaeflvqaamdtglkvpqgiklelglnteeialmlgttrqtvsvllndfkkmgil
ervnqrtlllkdlqklkefss

SCOPe Domain Coordinates for d2fmyc2:

Click to download the PDB-style file with coordinates for d2fmyc2.
(The format of our PDB-style files is described here.)

Timeline for d2fmyc2: