Lineage for d2fmyc1 (2fmy C:2002-2138)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1808270Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1808496Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 1808497Protein automated matches [226927] (11 species)
    not a true protein
  7. 1808503Species Carboxydothermus hydrogenoformans [TaxId:129958] [225203] (1 PDB entry)
  8. 1808506Domain d2fmyc1: 2fmy C:2002-2138 [204239]
    Other proteins in same PDB: d2fmya2, d2fmyb2, d2fmyc2, d2fmyd2
    automated match to d1ft9a2
    complexed with hem, imd

Details for d2fmyc1

PDB Entry: 2fmy (more details), 2.2 Å

PDB Description: CO-dependent transcription factor CooA from Carboxydothermus hydrogenoformans (Imidazole-bound form)
PDB Compounds: (C:) carbon monoxide oxidation system transcription regulator CooA-1

SCOPe Domain Sequences for d2fmyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmyc1 b.82.3.0 (C:2002-2138) automated matches {Carboxydothermus hydrogenoformans [TaxId: 129958]}
atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl
ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl
gdllknsltiinglvfk

SCOPe Domain Coordinates for d2fmyc1:

Click to download the PDB-style file with coordinates for d2fmyc1.
(The format of our PDB-style files is described here.)

Timeline for d2fmyc1: