Lineage for d2fmya2 (2fmy A:139-219)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984229Species Carboxydothermus hydrogenoformans [TaxId:129958] [225204] (1 PDB entry)
  8. 1984230Domain d2fmya2: 2fmy A:139-219 [204236]
    Other proteins in same PDB: d2fmya1, d2fmya3, d2fmyb1, d2fmyb3, d2fmyc1, d2fmyc3, d2fmyd1, d2fmyd3
    automated match to d1ft9a1
    complexed with hem, imd

Details for d2fmya2

PDB Entry: 2fmy (more details), 2.2 Å

PDB Description: CO-dependent transcription factor CooA from Carboxydothermus hydrogenoformans (Imidazole-bound form)
PDB Compounds: (A:) carbon monoxide oxidation system transcription regulator CooA-1

SCOPe Domain Sequences for d2fmya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmya2 a.4.5.0 (A:139-219) automated matches {Carboxydothermus hydrogenoformans [TaxId: 129958]}
darlrlaeflvqaamdtglkvpqgiklelglnteeialmlgttrqtvsvllndfkkmgil
ervnqrtlllkdlqklkefss

SCOPe Domain Coordinates for d2fmya2:

Click to download the PDB-style file with coordinates for d2fmya2.
(The format of our PDB-style files is described here.)

Timeline for d2fmya2: