Lineage for d2fk9a_ (2fk9 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304037Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1304038Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1304196Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 1304197Protein automated matches [190497] (3 species)
    not a true protein
  7. 1304198Species Human (Homo sapiens) [TaxId:9606] [188711] (6 PDB entries)
  8. 1304199Domain d2fk9a_: 2fk9 A: [204223]
    automated match to d1gmia_

Details for d2fk9a_

PDB Entry: 2fk9 (more details), 1.75 Å

PDB Description: Human protein kinase C, eta
PDB Compounds: (A:) protein kinase C, eta type

SCOPe Domain Sequences for d2fk9a_:

Sequence, based on SEQRES records: (download)

>d2fk9a_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hssglvprgsmssgtmkfngylrvrigeavglqptrwslrhslfkkghqlldpyltvsvd
qvrvgqtstkqktnkptyneefcanvtdgghlelavfhetplgydhfvanctlqfqellr
ttgasdtfegwvdlepegkvfvvitlt

Sequence, based on observed residues (ATOM records): (download)

>d2fk9a_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hssglvptmkfngylrvrigeavglqptrwslrhslfkkghqlldpyltvsvdqvrvgqt
stkqktnkptyneefcanvtdgghlelavfhetplgydhfvanctlqfqellrttgasdt
fegwvdlepegkvfvvitlt

SCOPe Domain Coordinates for d2fk9a_:

Click to download the PDB-style file with coordinates for d2fk9a_.
(The format of our PDB-style files is described here.)

Timeline for d2fk9a_: