SCOPe 2.08: Domain d2fjmb1: 2fjm B:501-785

Lineage for d2fjmb1 (2fjm B:501-785)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (268 PDB entries)
   Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299

8. Domain d2fjmb1: 2fjm B:501-785 [204222]
   Other proteins in same PDB: d2fjma2, d2fjmb2
   automated match to d1suga_
   complexed with 073, cl, mg

Details for d2fjmb1

PDB Entry: 2fjm, 2.1 Å

PDB Description: the structure of phosphotyrosine phosphatase 1b in complex with compound 2

PDB Compounds: (B:) Tyrosine-protein phosphatase, non-receptor type 1

SCOPe Domain Sequences for d2fjmb1:

Sequence, based on SEQRES records:

>d2fjmb1 c.45.1.2 (B:501-785) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgsvk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgds

Sequence, based on observed residues (ATOM records):

>d2fjmb1 c.45.1.2 (B:501-785) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekcaqy
wpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgv
pespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdpssv
dikkvllemrkfrmgliqtadqlrfsylaviegakfimgds

Timeline for d2fjmb1:

• d2fjmb1 first appeared in SCOPe 2.03, called d2fjmb_
  
• d2fjmb1 appears in SCOPe 2.07