Lineage for d2fh8a3 (2fh8 A:403-965)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081975Protein Pullulanase PulA [159381] (1 species)
  7. 2081976Species Klebsiella pneumoniae [TaxId:573] [159382] (6 PDB entries)
    Uniprot P07206 410-972
  8. 2081982Domain d2fh8a3: 2fh8 A:403-965 [204218]
    Other proteins in same PDB: d2fh8a1, d2fh8a2, d2fh8a4
    automated match to d2fhfa5
    complexed with ca

Details for d2fh8a3

PDB Entry: 2fh8 (more details), 1.9 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with isomaltose
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fh8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fh8a3 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
pegwdgltmphaqktkadlakmtiheshirdlsawdqtvpaelrgkylaltaqesnmvqh
lkqlsasgvthiellpvfdlatvnefsdkvadiqqpfsrlcevnsavkssefagycdsgs
tveevltqlkqndskdnpqvqalntlvaqtdsynwgydpfhytvpegsyatdpegtarik
efrtmiqaikqdlgmnvimdvvynhtnaagptdrtsvldkivpwyyqrlnettgsvesat
ccsdsapehrmfakliadslavwttdykidgfrfdlmlyhpkaqilsawerikalnpdiy
ffgegwdsnqsdrfeiasqinlkgtgigtfsdrlrdavrgggpfdsgdalrqnqgvgsga
gvlpnelttlsddqarhladltrlgmagnladfvlidkdgavkrgseidyngapggyaad
ptevvnyvskhdnqtlwdmisykaaqeadldtrvrmqavslatvmlgqgiafdqqgsell
rsksftrdsydsgdwfnrvdyslqdnnynvgmprssddgsnydiiarvkdavatpgetel
kqmtafyqeltalrkssplftlg

SCOPe Domain Coordinates for d2fh8a3:

Click to download the PDB-style file with coordinates for d2fh8a3.
(The format of our PDB-style files is described here.)

Timeline for d2fh8a3: