| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (87 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [187193] (7 PDB entries) |
| Domain d2fe3b_: 2fe3 B: [204207] automated match to d2o03a_ complexed with zn |
PDB Entry: 2fe3 (more details), 1.75 Å
SCOPe Domain Sequences for d2fe3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe3b_ a.4.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
ahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynn
lrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtg
fkvshhrleiygvcqecskkenh
Timeline for d2fe3b_: