![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196470] (52 PDB entries) |
![]() | Domain d2fdyd_: 2fdy D: [204205] Other proteins in same PDB: d2fdyb2 automated match to d1dt6a_ complexed with d4g, hem, so4 |
PDB Entry: 2fdy (more details), 1.95 Å
SCOPe Domain Sequences for d2fdyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fdyd_ a.104.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavrea lvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriq eeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifq ftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfids flirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvhee idrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgte vypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelf lffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr
Timeline for d2fdyd_:
![]() Domains from other chains: (mouse over for more information) d2fdya_, d2fdyb1, d2fdyb2, d2fdyc_ |